DPCstruct | MC10868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 11 aa |
| Standard deviation of domain lengths | 10.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.96 |
| Pfam Score | 50.00 |
| Assigned Pfam label(s) | PF19292- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821W7S1 | 1-117 | MLYLAMYVRSQPSLFAEMLRLRIGLIIQVMATELARSLNCSGEEASESLMSLSPFDMKNLLHHILSGKEFGVERSMRPIESSVTSPA… |
| A0A182U8Z4 | 96-193 | LSQELLVYLAMFIRTEPQLFHEMLRLRVGLIIQVMAKELSRTLNCDGEQASEHLLNLSPFEMKNLLHHILSGKEFAINSVARGNISI… |
| A0A6B0SD35 | 71-192 | None |
| A0A7R8WS96 | 60-165 | None |
| A0A7R8CVB2 | 12-133 | None |
| A0A5J5CLW7 | 786-896 | None |
| A0A4D9DJ56 | 729-866 | None |
| G1NP99 | 290-415 | None |
| A0A401NUD0 | 131-250 | None |
| A0A401PAS5 | 717-839 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.