DPCstruct | MC10867
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 341 ± 59 aa |
| Standard deviation of domain lengths | 58.56 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 62.22 |
| Assigned Pfam label(s) | CL0208- CL0271- PF13764 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821V6K8 | 27-373 | GLTCCICREGYKFQPTKVLGIYTFTKRVSLEEAENKPRKQQGYSTVSHFNIVHYDCHLAAVRLARGREEWESAALQNANTKCNGLLP… |
| A0A7S1LQ01 | 12-335 | DDNICCFATGKLYTETLLGVGVSRERANLSSAGELLAKEAFDGGHRQGTNKAAFEFFLPVWINKAHAAGSPLWCDALERCVTGIGAR… |
| A0A507FQ17 | 445-782 | None |
| A0A7S0AA38 | 31-406 | None |
| A0A368EYU1 | 4-241 | None |
| A0A3P8GLW2 | 27-382 | None |
| A0A183HL73 | 5-230 | None |
| A0A819U8Y4 | 3-480 | None |
| A0A4Q4YAL5 | 132-518 | None |
| A0A5N6JU37 | 3-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.