DPCstruct | MC10866
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 15.11 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 36.09 |
| Pfam Score | 79.95 |
| Assigned Pfam label(s) | CL0547- CL0022 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4RBE3 | 92-183 | MLDMKEIGLPSLRNITRGAVRIEKNADLCYLNTVDWSLVLDSEQNNYVAGNKPAKECGDVCPGDADGNSRCEKTLKNGNFACRCWSS… |
| A0A821SQF0 | 1-118 | MPHLRDIGLLSLTNILRGAVRIERNQELCHVSTIDWSLMSDTVESHYMVGNKPLEECADVCPGLSQSSCVKTVISGVQEPRCWTSRH… |
| A0A183VI04 | 2-106 | None |
| Q8C4P9 | 120-240 | None |
| A0A5K4E9E6 | 120-232 | None |
| A0A1W0XDI9 | 178-261 | None |
| A0A1B0C601 | 487-606 | None |
| A0A3P7HZ01 | 152-289 | None |
| A0A183MRB4 | 156-260 | None |
| P14617 | 120-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.