DPCstruct | MC10865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 79 ± 3 aa |
| Standard deviation of domain lengths | 3.34 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.77 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | PF00621- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821QZD7 | 1-77 | MEEAIITMTAVAWYINDMKRKQEHAVRLQEIQSKLVNWQGPDLSGFGELILEGTFRLQRVKKERAFFLFSKMLLITK |
| A0A3Q2YBT3 | 14-94 | EVVQEAIDTMTGVAWYINDMKRKHEHAVRVQEIQSLLINWKGPDLTTYGELVLEGTFHVLRAKNSRTLFLFEKMLLITKRR |
| A0A0N5CR51 | 224-301 | None |
| A0A6P9B7Z0 | 69-149 | None |
| A0A6A4V0S5 | 91-166 | None |
| A0A0M3I465 | 130-208 | None |
| U4U3N3 | 35-110 | None |
| A0A423SSQ6 | 147-224 | None |
| A0A1D2MKZ0 | 67-141 | None |
| A0A1I7VXR6 | 65-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.