DPCstruct | MC10863
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 221 ± 21 aa |
| Standard deviation of domain lengths | 21.48 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821PU95 | 2-202 | TSSSCVFLLAPDLVPSEYAEAAITSVLVPVLEGVHKLTSEEQMSAVSGAVGAFMEAWLGHILQERMRFSLQGALQLRCDFELVRELL… |
| A0A182JGS2 | 148-382 | DDPLEVQVQVCVALREKLVSEIKENIIKLKATCTECIDVLAAVCRTTSLASLTLCFPYFKHWQTEVLQERSNEYVAYFFNQIYLPVI… |
| F6R946 | 31-246 | None |
| A0A833RCX8 | 120-338 | None |
| A7RLI0 | 742-955 | None |
| A0A1I8HIL0 | 2-206 | None |
| A0A3P8NZT5 | 431-641 | None |
| A0A6I9Q688 | 10-250 | None |
| A0A3B3XSN3 | 846-1101 | None |
| B3S3B6 | 647-840 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.