DPCstruct | MC1086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 106 ± 18 aa |
| Standard deviation of domain lengths | 17.67 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3MFV5 | 13-108 | LTHMVDWDALGGRSNGAEDRLRRHLTSASVLAVPPRPHTATAVIVGARRDGYIPPAAVKALHEHWPGSELRWLPGGHATMIWRQKDA… |
| S4PPV1 | 7-105 | KIDISKIHWRDREALQFMRGIMDECTHLSNFSIPFDTSLIIAVCAKHDAYVPREDVGTLEEIWPGAEVRYVDAGHVSAYILHQSLFR… |
| A0A1B6LKQ6 | 166-297 | None |
| B7Q0M7 | 95-208 | None |
| A0A1Y1KE77 | 42-158 | None |
| A0A183BBG2 | 27-128 | None |
| H2YPB4 | 153-292 | None |
| A0A817GPR6 | 245-368 | None |
| A0A183TBB4 | 58-151 | None |
| A0A654GMC8 | 227-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.