DPCstruct | MC10854
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 109 ± 9 aa |
| Standard deviation of domain lengths | 9.18 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 23.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A653TL84 | 1-107 | MKHILRTWVVLTLAGLISACGGPELNGKSQETLLTSMQEIIESLDTKEAHQFQKDYVYISTSMLNDVKFDLNAINTKQNEILEAFDG… |
| A0A432W3S3 | 5-99 | YKVLLASIFALALAACSGGEPTLDMTNESAFDSSIQNVMAELDEAEQERFSEALSAIMMDEMMKGMSEGKSEEEIETAMKDRVQGKT… |
| A0A661HLX0 | 3-104 | None |
| A0A5C6UGI5 | 5-116 | None |
| A0A2D8XIL8 | 2-121 | None |
| A0A5P9ISW1 | 7-109 | None |
| A0A6P1PWR5 | 1-107 | None |
| A0A794VKB6 | 10-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.