DPCstruct | MC10850
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 292 ± 66 aa |
| Standard deviation of domain lengths | 66.18 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 72.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5WQ00 | 23-292 | SPMYKRVALVLQMIQYTELLWEMAAKRKGEKVRWRVIVLLEVIKAVCRLLLLRLTNSRPLVSPPLPQREVDPSSLEDSSASADGMDT… |
| A0A151ZD51 | 5-327 | GRYSDSELFSEALYSITNLFQLFIDYESANVLLLANHSKTSNGDVLPPHYYLPTLKWINIIQNLELFLEVLASKKFSKFGRKTTILI… |
| A0A2V3IZF2 | 9-389 | None |
| A0A1C7NRA0 | 1-216 | None |
| A0A5N6XPK1 | 665-960 | None |
| A0A0G2JV14 | 55-307 | None |
| E1BVC0 | 8-237 | None |
| A0A0D2NUZ4 | 362-588 | None |
| A0A1Y1I5V1 | 380-577 | None |
| A0A0S4JKY6 | 1-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.