DPCstruct | MC1085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 153 ± 22 aa |
| Standard deviation of domain lengths | 21.64 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.65 |
| Pfam Score | 87.84 |
| Assigned Pfam label(s) | PF09435- PF04063- PF04064 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1PIK1 | 87-244 | RRGGTIGILKNICFDPVYHDIILRDPDDILCALLYPLCGPEEFSDEENDMLPIDLQFLPETKTREEDPDLRKMLLESLLQLCSRRKS… |
| S4PNT5 | 6-147 | RRSGMVRIVRNLSFDTSYHVFLLSEDLDLLSYLLPPIMGNEEYSDDEMEKLPAAVQYYSKDKRRDCVLEIRKEIIETLNKLCAKRHG… |
| A0A7R9ZPA1 | 16-150 | None |
| A0A7S0YAG2 | 2-169 | None |
| A0A7S2RP18 | 34-188 | None |
| A0A3Q0KHM8 | 13-187 | None |
| A0A1I7VHS3 | 6-113 | None |
| A0A401RK92 | 68-225 | None |
| K7H927 | 2-117 | None |
| A0A0N1HEC9 | 197-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.