DPCstruct | MC10848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 155 |
|---|---|
| Mean domain length (aa) | 109 ± 22 aa |
| Standard deviation of domain lengths | 21.52 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.24 |
| Pfam Score | 71.33 |
| Assigned Pfam label(s) | CL0172- PF10780- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151Z8C2 | 61-154 | SHNLQEIRIHFCQSAQSSEGLRNFVVKNYSDIKKLNPKLPFLIREAHGIEPVIYARYDWGKEEKKVVTNLTEQEVEEKLKELCLLGN… |
| A0A452RUR7 | 25-126 | QLQRLSFSLSRDAPSSRGAREFVEREVADFARRNAGVVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEIATLVQKLADQSGLE… |
| A0A811MS74 | 8-97 | None |
| A0A199VTM8 | 3-109 | None |
| M9LXE0 | 21-143 | None |
| A0A0S8B094 | 6-124 | None |
| A0A7R9KME6 | 580-710 | None |
| A0A654HER3 | 145-234 | None |
| M1VC65 | 15-132 | None |
| A0A7S1QP37 | 8-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.