DPCstruct | MC10845
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 5.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RTD5 | 1-64 | MSSINGGGSGEEESEVHVLAVDDSSVDRAIVAHLLRSSKYRVTTADSGKRALELLGLESSELKE |
| A0A7J7DVT9 | 1-68 | MGMAAAESQFHVLAVDDNIVDRKLIERLLKTSSYQVTTVDSGSKALEFLGLQEHDLISPNTPSVSPNN |
| A0A178VRF0 | 1-68 | None |
| A0A822Z790 | 24-95 | None |
| A0A1J7G9R6 | 1-73 | None |
| A0A0D3DY53 | 10-85 | None |
| G7KIT5 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.