DPCstruct | MC10844
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 342 ± 35 aa |
| Standard deviation of domain lengths | 34.64 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453RAD3 | 149-468 | YSSNLPGKDLTPDTDRNEVEHCTQMGEMSDRSADEGDDDLFEHDDFASTPPKYTMTEKWIIDYQKRKYGENEKKVLEQQSAHKRMSA… |
| A0A438KLV9 | 1-350 | MEEELFGRVGVSLTGCERIFGAGEGVLMRSIFLMRDGLMEVGEFIDEPILWIFLRLGFDVGSIVEKRMALGEPLFLCMEEEETIKPH… |
| A0A2P5Y0F4 | 1-347 | None |
| A0A836AQ26 | 386-707 | None |
| A0A0M3I3Q5 | 54-464 | None |
| A0A504YFW4 | 121-411 | None |
| A0A484L5U3 | 470-819 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.