DPCstruct | MC10843
Metacluster Properties and Pfam Annotations
| Number of structural domains | 86 |
|---|---|
| Mean domain length (aa) | 270 ± 44 aa |
| Standard deviation of domain lengths | 43.78 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.37 |
| Pfam Score | 63.82 |
| Assigned Pfam label(s) | PF06883- PF04561- CL0410- PF04563- PF04567 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K9IBL6 | 180-427 | NGNIDLKLKHITPADIIASINYFFLLQQGIGSTDDIDHLGNRRIRSVGELLQNQFRIGLARMERVVRERMSIQDAETVTPQQLINIR… |
| A0A438KEK2 | 6-288 | QGNAISFVDKLVKSCKFPPGESIQECISKYLFPNFSGVKQKARFLGLELAGELLERELRVHIRHAERRMVKAMQRELYGDRDLRPIE… |
| A0A835IM96 | 9-237 | None |
| A0A086L503 | 427-763 | None |
| A0A4S8I2F4 | 37-326 | None |
| A0A0G1YM35 | 295-577 | None |
| A0A6C0JBE8 | 211-500 | None |
| A0A2A2KTH8 | 164-452 | None |
| A0A1P8BFS9 | 274-582 | None |
| A0A1I8FR00 | 108-407 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.