DPCstruct | MC10842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 66.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 55.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2Z6N5M8 | 209-275 | SMATASKNNNDEVDGKPGPTALFVKVSMDGAPYLRKVDLRTYTTYQELSSALEKMFSCFTLGEQLLF |
| A0A438KCC2 | 1-77 | MASNLPKNNEGAEGKLGSRCLYAKVNMDGAPYLRKVDLKLYCTYMELSSALEKMFSCFTIGQCGSNGVPIRDGLSES |
| A0A1D6M103 | 12-83 | None |
| A0A834ZNB0 | 335-404 | None |
| A0A446PKP4 | 3-68 | None |
| A0A843X772 | 115-188 | None |
| A0A5N5HPX6 | 237-305 | None |
| A0A426XZ38 | 105-163 | None |
| A0A397YJ79 | 1-72 | None |
| A0A1D6L0F8 | 58-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.