DPCstruct | MC10841
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 25.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 26.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3NTV4 | 5-128 | QYIRLMALACIEMSSTVPISIVSLYISNEAVPIQPWISWDNVHYNFSHVGLYPTVIWRSDPSYVAAVEMSLWLFPACALLFFTLFGF… |
| M5CFI7 | 76-218 | TVRELLNRRRQFANMLSTSRSGLNTSQYFRLMALAATEMLLSLPLSLYILITFIMAPQNPWISWADTHQGFGNITFEAWESVELNPS… |
| A0A1B9HEX4 | 1-194 | None |
| A0A166HMD9 | 1-182 | None |
| A0A4Y7T3N5 | 91-244 | None |
| A0A166F717 | 87-272 | None |
| A0A0K6GI95 | 17-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.