DPCstruct | MC10840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 11.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 43.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A6B5R1 | 352-460 | IDNLKIFSWNPARNILAYYSEGEENTPAEFGLLDIPSGTKLRTARIYNVAEAQMWWQESGMRMAIHTLRYQKKATKENGDVKYIGGT… |
| M5C7C0 | 3-85 | AYWVPEVANQPARVTLLALPSRTQLRTKNLFSVSECKLYWQNQGDFLCVKVDRPTKSKKATFCNLEIFRTREKDFPVEVIELK |
| A9V6L5 | 326-407 | None |
| A0A409VDU7 | 373-455 | None |
| A0A6J3GPD0 | 476-558 | None |
| A0A287QA33 | 4-80 | None |
| A0A4W5Q2D3 | 1-69 | None |
| A0A183BXD4 | 591-697 | None |
| A0A4P1LX85 | 787-869 | None |
| A0A1X2HE58 | 367-449 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.