DPCstruct | MC1084
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14242 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8HPB7 | 1-135 | MHNELDKIDILRGRLDISYKEAKAALDAAGGDVVEALINLEGEKADAEERFQDRGQEIWGQLKELLHKGQGYRIKVKKGDKTVLRVP… |
| A0A1W1XP00 | 2-141 | SIDLKLIDELKKRADVSYEDAKEALEKNNGDLVEALIYLEKQNKVKTEPENGFISSVKKIIKKGNRIKFIIKKEESTILSIPLTAGI… |
| A0A7C6MS31 | 2-158 | None |
| A0A645BQB5 | 1-135 | None |
| F0T1L6 | 1-152 | None |
| A0A7X8KWH2 | 6-148 | None |
| A0A1Y4FPR0 | 6-205 | None |
| A0A1H8FAG9 | 3-171 | None |
| W6S778 | 26-193 | None |
| A0A1Y4C5S6 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.