DPCstruct | MC10836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 384 ± 37 aa |
| Standard deviation of domain lengths | 37.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 69.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E3XQU8 | 29-407 | LSELGAFIKGGGAVERFLDAAVSVCNSLPFVISVASSECIDTVAPAILGLFPISAPAWSETLLGWRIFLELFRTAYFLPVPRSDKHE… |
| M5C4C5 | 56-417 | ILFAQKKLWTTGKVADVVQALADIEPDLLEFLMSDEELRGAVRTSVCGSAFPATRVVWLNSLSYSLFQRFLTYINRLPPNLNLVDRA… |
| A0A7C8JH05 | 140-469 | None |
| A0A1C7MRR5 | 1-390 | None |
| A0A166KJK6 | 23-463 | None |
| B8P022 | 12-318 | None |
| A0A3A3A115 | 101-511 | None |
| A0A4Y7RQ06 | 42-421 | None |
| A0A498J4J1 | 363-766 | None |
| A0A0C3L9I0 | 16-415 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.