DPCstruct | MC10835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 118 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 37.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A175VSQ4 | 330-447 | IFLRVTSARVATSVTAAFAAELERATKKPPPKVTKISILTSSYDEAMASDTSSSNQATKIADVFASVLPSKKPGGRIFIGFPTTQTT… |
| A0A818MHF8 | 59-173 | LMHIDVNAKLNIDEEFHNQIRRILKKSLPSNVRIQLLYAPSDIVSQLRNISLNDAHLETQILHSLLPLKCHENQIIPSGLVFIGLGT… |
| A0A821JRK8 | 15-138 | None |
| A0A015KCE5 | 1-121 | None |
| A0A507CL54 | 40-166 | None |
| A0A7S0BRV7 | 128-234 | None |
| A0A819W2S5 | 328-443 | None |
| A0A4D8Y5M2 | 217-328 | None |
| A0A4P9W3N8 | 249-359 | None |
| A0A821P7C4 | 60-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.