DPCstruct | MC10834
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 150 ± 19 aa |
| Standard deviation of domain lengths | 18.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09335 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5C3Y5 | 1-138 | MAAQTQPQHPPPRAPSPTPSEKEDLDRGVVNWNKVLRWQTWLKMKYIPWYIGLAIILALTVLMTLYLKELVHWLRPAADWMHELSVG… |
| A0A136JDH4 | 3-117 | KAPDLDCPSELLLADRRERNRWRRSCLSPWHILTYIFIIILVALTVIVTLFHVQVVRILSPFSAIIRDLPAGFLIPGAIAFAISYPP… |
| A0A1B9HRW3 | 119-277 | None |
| A0A0J0XV99 | 5-164 | None |
| A0A7D8V2Z2 | 22-166 | None |
| A0A164SZ12 | 1-163 | None |
| A0A409YI67 | 365-487 | None |
| A0A4S4L3Y7 | 198-369 | None |
| M5C480 | 1-145 | None |
| A0A316VE03 | 186-365 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.