DPCstruct | MC10833
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 167 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517KWV0 | 89-261 | GGTLDTQVWVGFTALITTVSLVLAYINIKRLQIDQHRIWMLRAWFYLASIISERIIGLAVHAIISRIGSYWFAMRCSKVVSIMATYG… |
| M5C3Q5 | 2-164 | LSSGAACAVIFGCVEARRGALDAHREWMIRAWFYNGALVTTNITALISAHVITAINTYYSLWRCAEVGYVLQSADALAQAYPQCVTS… |
| A0A2H3CE26 | 176-344 | None |
| L2GDZ0 | 131-321 | None |
| A0A5N5WV11 | 139-315 | None |
| A0A2P7YJM4 | 150-309 | None |
| A0A2T3AXW3 | 59-237 | None |
| A0A4S9C538 | 147-289 | None |
| A0A4S8KM56 | 190-348 | None |
| A0A5N5QE46 | 9-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.