DPCstruct | MC10832
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N8F4G5 | 1-87 | AVPLLERVVRDQRSIIADVTGRPASETPQVWALYKEVQDYYDHGMQVPDDVILLFADDNWGQIRRLPGPGAQPRRGGYGVYYHFDYV |
| A0A2K9NHZ1 | 5-83 | RTLLNRIIADQRRLLAQNVSPDIERLPQVFTPYKEVLALYRAGLDLPDDVTLVWPDDNFGYIRQFPNAAERSRTGGSGV |
| E4ZZY4 | 104-202 | None |
| A0A4Z0A344 | 452-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.