DPCstruct | MC1083
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Standard deviation of domain lengths | 13.88 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 28.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A371PCG9 | 3-149 | TTRYELVQRAGIWLDRWTAQLWDKLVAKFPGLILTQGVNSGAAASAGTHRGLGVLDLYLGRWAAKWRDVLRYAFDIGFFGWYRPELW… |
| A0A7Y5WIP8 | 13-164 | AGYTSFRGRTACVCLAEWLPVLERLLLAHGVIKQSLDVVQLTGGAPASGGTHTQGGAFDIRQRDAVTVRVVREMGAPAFWPRTGPAW… |
| A0A6N6L830 | 2-143 | None |
| A0A7Z0CY35 | 216-376 | None |
| A0A4R6JGR1 | 2-135 | None |
| A0A523HQL8 | 106-276 | None |
| A0A2M8PQP3 | 157-329 | None |
| A0A2M8Q310 | 47-203 | None |
| A0A838RKT6 | 299-486 | None |
| A0A814FPP3 | 2-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.