DPCstruct | MC10828
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 141 ± 15 aa |
| Standard deviation of domain lengths | 15.02 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 27.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5C0D4 | 1-128 | MNPTPIASHTISLALQYLLPPSELPTHLISRPLLQRHHFLSISPTDAAAYFCWPRPGADPEKSVAALEHLAAQDHEWLVRTAEIRYQ… |
| A0A316VYR3 | 12-157 | AVISAGVKLLPMLLTHPPYIPASMKSDELNQRHRLLDMQPDEDGYLFSDVFGHAPGTATRVTSRIQALQQQLEALLGIQPSAASAVK… |
| A0A165PNK5 | 1-163 | None |
| A0A0C3SDM6 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.