DPCstruct | MC10826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 189 ± 10 aa |
| Standard deviation of domain lengths | 9.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 38.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BXV8 | 1-200 | MTHSSSSAYIQVTFCGYKVLYTYERFAWIPIVMVYLVALGCGGKHLTNLPPVVPASSVTVLCFAASIAGYMISWATLASDYTIYLDQ… |
| A0A093ZIT7 | 182-372 | IALVVSFSGYKVLHIYERYSWIPVFIAILILVGCSGKKLTLQTVPEAPATVQSVLSFASLIAGFMIPFGGTVSDFGIYIDPFASRLK… |
| E3Q938 | 86-276 | None |
| A0A0C3AW22 | 144-315 | None |
| A0A0G4KUM9 | 527-720 | None |
| A0A178EQK1 | 504-687 | None |
| C4JV58 | 467-657 | None |
| A0A817RB17 | 2-178 | None |
| A0A166Y156 | 195-387 | None |
| A0A1V2LV39 | 48-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.