DPCstruct | MC10825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 212 ± 33 aa |
| Standard deviation of domain lengths | 32.78 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 26.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7TGK2 | 221-429 | VEEVWFAGCHCDVGGGSVSNATKHSLARIPLRWMIRECFRSETGIMFKADELRRLGMLPESLYPVVLPRSPALGPEPPKFIERMPPS… |
| M5BWT2 | 28-208 | RIPLRWMIRECFVNNTGILFHSSELAEIGLSPCSLWPVVKIPIPPTPPPAVQVKHELEPTDGTLVDSPPATPLPGNPLLPLTPLTLA… |
| A0A409XY86 | 816-1087 | None |
| A0A072PVA1 | 790-1063 | None |
| A0A1L9PJQ7 | 284-486 | None |
| A0A5N6X3K4 | 368-584 | None |
| W2RYG3 | 552-814 | None |
| A0A2G8SCG4 | 131-312 | None |
| A0A0K6GGH9 | 405-635 | None |
| A0A0K6FWR9 | 31-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.