DPCstruct | MC10823
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 158 ± 27 aa |
| Standard deviation of domain lengths | 27.27 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 45.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0286 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BVW8 | 335-490 | KYVIPKSRYGSVDMYLSQDFNNRPEYNDVPVLIDEKVYDRLRENNIDDLLAKHIAHLFIRDPLVVFSEAIELDDTKSTDHFESLQST… |
| A0A077X2Q5 | 268-421 | RFVINKSRYDSIDTYICDDAMYKSKYNDLDLVYDKDIYQKLRDNDVDDLLARHIAHLFIRDPLVIFKELLDQDDEKSMDHFENIQST… |
| A0A1J8QCX6 | 48-207 | None |
| A0A1J8Q9X5 | 162-310 | None |
| A0A183M0T0 | 113-290 | None |
| A0A815FFZ9 | 78-289 | None |
| A0A812BKJ1 | 4-138 | None |
| A0A5J4NP53 | 3-135 | None |
| A0A5J5CX00 | 935-1072 | None |
| A0A183J936 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.