DPCstruct | MC10822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 147 |
|---|---|
| Mean domain length (aa) | 100 ± 13 aa |
| Standard deviation of domain lengths | 12.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02671 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BUG8 | 3-98 | LSPGSRSLNVMDAMTYLETIKVEFQHKPDVYDRFMDIMRDFRSEVINTPEVINQVLLLFNKHITLIQDFNAFLPQGYRVNCTTDDHN… |
| A0A165BZS3 | 18-115 | PASLFLSSVRLHFLDDQQAYTYFQDTQIRYSRKELDVVTFVHRNAVLLQRDVDLLKQLFPFLAPYACHVAQAPTHFTVTISHPQMAT… |
| A0A836AKE9 | 1-111 | None |
| A0A6A6LIL7 | 1-129 | None |
| I1I3B3 | 3-84 | None |
| A0A445JKN5 | 95-189 | None |
| A0A2W1B756 | 92-210 | None |
| A0A7N2KZ66 | 82-176 | None |
| A0A1P8AQ85 | 4-94 | None |
| A0A0G4M8Y3 | 96-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.