DPCstruct | MC10821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 158 ± 44 aa |
| Standard deviation of domain lengths | 43.64 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 77.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 90.76 |
| Assigned Pfam label(s) | PF09320- PF06212- CL0392- CL0629 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BBJ1 | 3-107 | SGYFISEPVYSLTPSSKYPVPRDTQHLKVPYYVKENFHTDYQGSLRRLEMAIEEEYIVGLRHACQRERNYRDSMVWKARNFGDSRQY… |
| M5BTT4 | 39-221 | QRFGGPPRRAAGQQQAAEGGDTRSIFVQLLPLIALLAISLFSSLLSFVTTGGTPSYPGFRYDASKSFNVEQTTTRLNVPYFVSPSEW… |
| U7PHA5 | 178-374 | None |
| A0A0R3T439 | 201-350 | None |
| A0A1I8FQY9 | 283-421 | None |
| A0A2U1QK21 | 24-147 | None |
| A0A2U1QBZ8 | 11-154 | None |
| A0A6P5VL50 | 212-364 | None |
| A0A0D2Q8N1 | 1-246 | None |
| E9GD69 | 210-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.