DPCstruct | MC10820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 179 ± 37 aa |
| Standard deviation of domain lengths | 36.71 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9U188 | 180-339 | LFICACAANEMLPLSPALPADLLTSCLTTPLKMALEWYIGFSQLKILLPHVTDDMIRSLPGDITDPCTPQGDLQLVLTAVTETVAWC… |
| M5BT91 | 9-227 | QASRPFTDCIQLAACAADEVLPMTPELPADVFTACLTSPIEMALRFFALRNPLPSNPTRSGVPHLDNVMQLPGDLKDRRTPLGELNW… |
| A2DJF0 | 245-381 | None |
| A0A182GD92 | 166-310 | None |
| A0A2H2JLR4 | 92-276 | None |
| A0A835CR32 | 78-246 | None |
| A0A453KDL8 | 41-204 | None |
| Q68TI8 | 300-484 | None |
| A2DKJ0 | 93-244 | None |
| A0A7J6UAU7 | 249-509 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.