DPCstruct | MC10818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 141 ± 5 aa |
| Standard deviation of domain lengths | 5.22 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 44.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A427Y7J0 | 564-706 | DDNDSKHKDFLLFSTSGATDIKDTVYTTTDTAVSPGGALVSNVTAIVPTEFIDIIDDTQLGRFGICNNCDYSVNLINGKWESIAIAS… |
| A0A2R7LGN1 | 96-235 | RSVLLVETAWATNIAGSAFETSTLPVAPEGVLNPGVTPARQTELVNLINPVQLARFGLNLDNAAPTPLTLPEKFEALALVPALDPKA… |
| A0A1B9H781 | 651-789 | None |
| A0A7V8FIW7 | 1-130 | None |
| A0A2R6NWA2 | 277-419 | None |
| A0A1Q3E082 | 229-378 | None |
| A0A427XQD3 | 773-913 | None |
| A0A5E3WRD0 | 345-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.