DPCstruct | MC10817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 376 ± 32 aa |
| Standard deviation of domain lengths | 31.59 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 72.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0110- PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177WDC7 | 36-407 | ANKTAHPSSRGMRRTMGFAAETTNKGRGNTRDQAIIGTLGRSKKLTHPERQTDIVNILAPEPENKYGPWSIFVFLVTCCFPSVLLSR… |
| A0A093Z8B1 | 31-375 | WVFFVYLLTWFIPDFLIRWVGRMKRKDVRMAWREKLAINIMIWFSCLLFVFIIIVFPMLICPRQHVFSPSELSAHDGKPGSPGAFVA… |
| A0A015KZG8 | 303-620 | None |
| J4U549 | 19-377 | None |
| A0A507EY19 | 70-448 | None |
| A0A642VAI3 | 503-882 | None |
| A0A1R1PJD1 | 5-386 | None |
| A8Q254 | 64-485 | None |
| A0A0L0VZ20 | 257-673 | None |
| A0A433PJ51 | 352-769 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.