DPCstruct | MC10814
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.92 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CAH6 | 1-122 | MSLSPKSNMSIEAREWQQLQSKKFSEKRKFGFVEAQKEEMPPEHVRKIVRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPM… |
| M5BPJ7 | 5-137 | PPPPPGFVPPPPGMPPGLPHPQQMDSMRMPSEVLAQKSHKWVQMQNKRYGEKRKAGFIDTGKQDLPPEHVRKIIKDHGDMSNRKFRN… |
| A0A0G4KG05 | 16-163 | None |
| A0A6J5UGJ4 | 7-140 | None |
| B8C3V5 | 465-603 | None |
| A0A7J7IGT9 | 9-159 | None |
| A0A817XLM4 | 71-223 | None |
| A0A512UK03 | 63-197 | None |
| A0A0B1SPH7 | 4-153 | None |
| D2V0Z6 | 50-183 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.