DPCstruct | MC10813
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 216 ± 30 aa |
| Standard deviation of domain lengths | 30.40 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7EQX5 | 2-200 | VTLSGLAPSRWVNLPYLDVIRERNKPIEPVRKPKTAPFFLPSVSTLDSFEFEKMDVDADVIERRNVLMAKRSVLEIESSFAETLLQA… |
| M5BP68 | 38-231 | LVTLTVLPRSKWQTLLNLEVIQARNKPTEAPKVPEKAPFFLPTVAGVDHQFDTSAEQTKKSKDESRRKQSGTVRVETEFQRQMSQEE… |
| B5VNU0 | 1-209 | None |
| A0A445D3T3 | 82-282 | None |
| A0A0A2V705 | 845-1113 | None |
| A0A6A2Y920 | 289-485 | None |
| A0A4Y2GKW2 | 56-272 | None |
| A0A5C6NIT6 | 1050-1236 | None |
| A0A6A6P2A6 | 946-1178 | None |
| A0A812UPS1 | 106-331 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.