DPCstruct | MC10812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 242 ± 35 aa |
| Standard deviation of domain lengths | 35.39 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 58.63 |
| Pfam Score | 86.76 |
| Assigned Pfam label(s) | CL0363- PF10597 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4YMR8 | 33-321 | EISGRIPTSLTSIEWEDSFASVYSRDNPNLLFSMCGFEVRILPKIRAKELSSSQEGVWDLVDQNTRERTAKAFLQVSQEAVDHFHNR… |
| M5BN70 | 936-1188 | KDNPQLLFSMCGFEIRILPKIRTMSGEQFSLKDGVWNLTNEQTKERTAQAFLRVSDDGIQQFNNRIRQVLMSSGSTTFSKIVNKWNT… |
| V6TPJ6 | 131-353 | None |
| A0A6G1DHY5 | 91-350 | None |
| A0A2P8XBN0 | 4-222 | None |
| A0A7S4PR46 | 119-398 | None |
| A0A7J7IER7 | 19-254 | None |
| A0A835LGD4 | 5-217 | None |
| A0A834Z7W1 | 1-244 | None |
| A0A1C7LWS0 | 1-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.