DPCstruct | MC10811
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 211 ± 21 aa |
| Standard deviation of domain lengths | 20.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 44.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5BN80 | 1-204 | MGGESYALSFDLVQYVATSPLVRSQTKGEEDQVTARWMKLHPRANEIVWWSERCLIYDHPKAGTVYSRGFLFPSELQRVRELEARRG… |
| A0A166U758 | 275-476 | MAGELYALSWSLASWVAADPVVRTMIKGKEDVTTARWMRQHPQASEIRWTNERCWIYDHPRAGTVYSHGFLFPSEATRVRRNIISFP… |
| A0A2S4V4I2 | 602-769 | None |
| F4R4M1 | 110-314 | None |
| E2LLU6 | 1-232 | None |
| A0A4S4N530 | 203-417 | None |
| A0A1J8QBV0 | 807-1010 | None |
| M5BZJ8 | 103-331 | None |
| A0A4S4LIM8 | 487-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.