DPCstruct | MC10810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 93 |
|---|---|
| Mean domain length (aa) | 417 ± 65 aa |
| Standard deviation of domain lengths | 64.70 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A409XAL7 | 46-463 | RRQVVYNAEERKVLDAHKERYLASKSVEEHKSVAKTYILPDIFQYWDDIGHEIGDSRTQTRKLVAWMQNTWRGTKVAETVIAGAAMK… |
| M5BM53 | 6-410 | FRRIEIDFLETYVPSWRELKGSAGDKIDKSTRLNARTLHVRKVVKEFLATFQERDPTFSDPSPITFTQEEVNDLGRRIRQWLNNNTR… |
| A0A0C9VFZ2 | 111-529 | None |
| A0A0C9V0D5 | 26-320 | None |
| A0A0C9V046 | 8-373 | None |
| A0A0C9UWZ3 | 234-650 | None |
| A0A0C9UNK1 | 49-468 | None |
| A0A0C3EG55 | 1-422 | None |
| A0A5B1QYI5 | 3-389 | None |
| A0A4Q9MHE1 | 1-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.