DPCstruct | MC1081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 179 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A814Q5Y7 | 4-196 | PKYPTLSKIVKNILIISHGNSDVERGFSINEHIITENRTLLSLSSINGLRSTWDAIKFYGAGSPHRVPIKIDMIRAVQKSKSVYNQE… |
| A0A816HP48 | 1-154 | DDRSLLSDESINGLRATRDGVKYFGNGKPHDVPITKNLLDCVRSAHSRYCDDLEKKKAKRTMTKTVEYEQAKQDTDKEKEYCLYDEQ… |
| A0A815SVY6 | 9-201 | None |
| A0A498NYK5 | 226-400 | None |
| A0A7R9B3Z6 | 1-196 | None |
| A0A4Y2A8K7 | 103-278 | None |
| A0A821R8H6 | 319-513 | None |
| B3G4K2 | 217-407 | None |
| J9M341 | 8-216 | None |
| A0A815TLT4 | 16-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.