DPCstruct | MC10808
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 145 ± 24 aa |
| Standard deviation of domain lengths | 23.71 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K8LB30 | 8-138 | LPAKPANLPHPDYHTPRGVSPLETVRAAGLEYPNYTPFKLPNLTPHPFTDRGQHADPSKSRLLSVATEVIHLTPDIGTEIAGLQLSA… |
| M5BI95 | 1-139 | MAPPVATETSTNTNNGSIPLIAPNPKSDYPYEHLLPTFDKNEFYPPLKPFEHIDPAARAAALPESEQRAFLKNATRIRNLTPKIGTE… |
| A0A6A5QKD9 | 1-157 | None |
| A0A4Q4VS41 | 777-940 | None |
| A0A1Q5QCB7 | 1-134 | None |
| A0A0G2ECX4 | 1-177 | None |
| A0A0P7B5K3 | 296-461 | None |
| A0A1S8A949 | 1-157 | None |
| A0A161HI66 | 1-161 | None |
| A0A1U8QL42 | 3-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.