DPCstruct | MC10807
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 186 ± 16 aa |
| Standard deviation of domain lengths | 16.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 34.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0507 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5QIY4 | 565-764 | ENIDHALRSALICNPGSHQIQRWLCDWLQVLLLRTRVVHTSMTYKALKSATPAFLQLVFSNPTLWPANCDLTSIPLANMLTSPRHEL… |
| A0A0B7G3W9 | 588-782 | IWEIPKKTAVRKREEESRRTSLTLLKLVVIDGTLGYTALRDGLPMFLQLVAEDPSLLIEQSDGNLVVSFPRALEYHRHELTRFAVYD… |
| A0A0B7FXN6 | 2-163 | None |
| A0A0B7FEU9 | 646-845 | None |
| A0A0B7F9I5 | 296-474 | None |
| A0A0K6G0J0 | 951-1143 | None |
| A0A074RMA5 | 3-173 | None |
| M5CGY4 | 145-319 | None |
| A0A0K6FUF3 | 92-283 | None |
| L8WFD0 | 5-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.