DPCstruct | MC10806
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 349 ± 48 aa |
| Standard deviation of domain lengths | 47.99 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K6G763 | 3-318 | LSRSPLYLRHFESPSLISGCIKLMASVQVAGKPSPFNYEYGYLCFKIITLAVGVCLLARRYELAGTISEMIADQDSILLDIFSRRVS… |
| A0A0B7G2R5 | 15-391 | HPKWGPTLSEYMPTFEERLTESFDKYIANEEILSEPLDDLIPLSLLETTLAVGENMHKVGFQSGDRIFPVLISTIRKYTNLYKGGVF… |
| A0A0K6G3E4 | 58-329 | None |
| A0A0K6G3N9 | 58-394 | None |
| A0A0K6FXV3 | 20-347 | None |
| X8J068 | 17-325 | None |
| A0A0B7FUZ1 | 9-436 | None |
| A0A5N5QH35 | 6-386 | None |
| X8IYJ4 | 37-398 | None |
| A0A0K6FXS0 | 54-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.