DPCstruct | MC10802
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 593 ± 72 aa |
| Standard deviation of domain lengths | 71.64 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 15.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E2CSD5 | 34-631 | GFIKSLISDPNAGWKNKEAKRRAKQDQETEKSRNGNIAELTPNLAVIASGAPTQFGVLRWAAEHYRNGRISQNKTPFENIIRYTNEE… |
| A0A4Q0S4G0 | 1-650 | MISHRGGIQLTDKDDAWVRKGLADQAASIDDREMMLYAQLNLLHRGAMSYREMLEGLRPLVSDSPHLAAIVDERMKPQEITAELRRM… |
| A0A7Z0HJG7 | 248-853 | None |
| A0A564WEX2 | 466-1089 | None |
| A0A4U7J7E0 | 568-1276 | None |
| A0A1E7I1C5 | 122-780 | None |
| A0A2G6JEI1 | 2-433 | None |
| A0A2R7KDR0 | 14-579 | None |
| A0A8B3S1V6 | 135-776 | None |
| A0A1I9Y1I2 | 274-914 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.