DPCstruct | MC10800
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 10.96 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A859I924 | 1-99 | MKRYDINVIEKEDIPNILEYFNIQTSTYNLEEPSYNPYGRKFFFNKLKNPPSGLLGVYFKPRINPFNEKYSHEDDEYTLEDLLKYEI… |
| A0A0P7IBM7 | 30-128 | EEFIGQTRIVHVSIGNINILKQHAIFNKYFDWSLQSARYNEDLEDFSMIWTIKDPDPNLLGVFFDGGIRHGQDDTYNLQELKHMGNG… |
| A0A559KJG3 | 57-184 | None |
| A6QKS2 | 2-91 | None |
| B3QZR3 | 28-116 | None |
| B3R0C6 | 533-638 | None |
| A0A559KJH6 | 275-387 | None |
| A0A139JRG7 | 57-144 | None |
| A0A531XZJ9 | 1-107 | None |
| A0A531Y0S9 | 84-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.