DPCstruct | MC1080
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 69 ± 9 aa |
| Standard deviation of domain lengths | 8.58 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 46.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9DVF0 | 130-193 | TGKAVQERNMYAIGVWKRVKAKLDGRDIDPTKRMSVEDQVEHIIEEATSKDNLCLMYEGWTPWV |
| A0A814MWA0 | 1-60 | TDERNKYAVEICKRIRDKLDGSDPDPLIQRSISEQVRYTIREATDIENLATLYEGWTSWV |
| A0A3S2N689 | 73-142 | None |
| U9TP27 | 158-224 | None |
| A0A7T8KC17 | 89-149 | None |
| A0A183H505 | 1-88 | None |
| Q10D69 | 226-287 | None |
| A0A287N7R9 | 4-65 | None |
| A0A7S4MP20 | 102-169 | None |
| A0A820FD84 | 115-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.