DPCstruct | MC108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.51 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 37.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9DNE4 | 1-92 | MADKYELLPADAPAGHIAHKRVRFDAKDGNRAMFRFKGQHFQTCTTKAGTRHAAEVIARACWMRFEDGEDKDAVTAFRNRCYEVVSS… |
| A0A7S4RHN7 | 178-272 | VDPLEAVLPQDAPAGHAAWEVVRFCSNHKYPYAVLQIGSGADRVRFQATMMASGSQENAMRIARACFMLFDSGASLEDVRKFRNDLF… |
| A0A813GIF2 | 1-109 | None |
| A0A812W6J3 | 59-170 | None |
| A0A812V563 | 679-758 | None |
| A0A812RSI6 | 184-276 | None |
| A0A813GW32 | 589-684 | None |
| A0A813GMP1 | 232-316 | None |
| A0A7S1A6P7 | 53-139 | None |
| A0A813ALQ6 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.