DPCstruct | MC10798
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 259 ± 39 aa |
| Standard deviation of domain lengths | 39.06 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A520MJ83 | 3-228 | EKIKYFIAGLFIGLSELLPGISGATVALMFGVYEKILNFLSRFKDFNLILPLIIGMIISVLSFSNIIDFLYKNYTDIFNFLIALLMI… |
| A0A1Q9S4U1 | 41-278 | SVRRSLPGNVVRGALIGVVETVPGVSGGTVALVVGIYDELINSAGHVVSAGKRLLLGPERAAGARHHLARVEWRIVLPVAIGMVAAL… |
| A0A7X5BAJ3 | 2-229 | None |
| A0A3M2FWF1 | 4-283 | None |
| A0A7C1UI89 | 59-356 | None |
| A0A2E3HRE0 | 7-368 | None |
| E2N7T0 | 2-234 | None |
| A0A357HCK7 | 106-399 | None |
| A0A150NMG2 | 4-206 | None |
| A0A7C7Z8Z9 | 25-244 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.