DPCstruct | MC10797
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 12.14 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 48.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C6TF03 | 40-125 | MLLALPCIHDGALSLDGGMIRGRGMFALGSRKDVEVKFPLISGGSDVPPNYIETEEAVRKLNWETSKLAADKHREQQLLDYRKGKL |
| A0A314Y8A0 | 1-89 | MRLALPCINDGALSLDGGVIKKSGVFILGSRKDIEVKFPATSGESSMPAKYLETEDMIKKLKWKRSHVTEDMQREQELLDFAKANFT… |
| A0A835IH12 | 251-337 | None |
| A0A6A2YC28 | 105-227 | None |
| A0A2G3CWT4 | 65-164 | None |
| A0A2P2KHU0 | 40-148 | None |
| A0A5N6LXY1 | 582-667 | None |
| A0A833TI86 | 86-180 | None |
| A0A6P4A4F9 | 198-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.