DPCstruct | MC10796
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 95 ± 9 aa |
| Standard deviation of domain lengths | 9.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0137 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314Y3A6 | 1-101 | MAASSGENSVESKSSLSGIAPLEAVLFDIDGTLCDSDPIHCHAFREMLQEIGFNGGVPITEEYYIENIGGRHNDDIARILFPDDFQR… |
| A8IR23 | 1-77 | VLFDVDGTLVESDPLHFKAFQEILSELGYNGGQPISEDFFRHHISGRHNPEIAADLFPDWLEERRTQFYMDKEERYR |
| A0A834L7R0 | 1-100 | None |
| A0A2G3BPK8 | 1-96 | None |
| A0A540M811 | 19-112 | None |
| A0A7N0T5Y7 | 98-194 | None |
| A0A804IBU3 | 2-116 | None |
| A0A498HNM2 | 185-273 | None |
| A0A2P6SEC2 | 61-150 | None |
| A0A2R6W4B9 | 34-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.