DPCstruct | MC10793
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 122 ± 16 aa |
| Standard deviation of domain lengths | 15.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A314XZ30 | 2-117 | SATKIRTSCLSPNFVAANSPQIPGLKHGPNGTMFISSGILDLDKILGGGLSLGSLVMVMEDAEVPHHMLLIRNFMSQGLVHNQPLLY… |
| A0A0P9EKD5 | 2-102 | SSFRRRTAVQPLGGTRPSPYNAAPLVSTGLTSLDDLVGGGLPLSTSLLVECDAPTSYADLVLRYWVAQGLECGQDTLVVASALDGGP… |
| A0A2H2IH56 | 3-112 | None |
| A0A6S7QGG1 | 1-125 | None |
| A0A843X1E7 | 41-159 | None |
| A0A6F9DCG4 | 1-123 | None |
| A0A287XX91 | 5-122 | None |
| A0A0M3IX84 | 81-215 | None |
| A0A183Q6I5 | 1-107 | None |
| A0A372QHR5 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.