DPCstruct | MC10792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 234 ± 28 aa |
| Standard deviation of domain lengths | 28.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 69.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7GD05 | 1-201 | MEWKSYYAFLMRCIRELTLKSDKQKVLMRLVCAVLDHFHFMETHFCQESNDSVVDVSKAGTTTLTSSVLHTYTSSAEVSEIQSCLHK… |
| A0A314XY33 | 1-276 | MLLEEHEGKGEHVKNVCIEALASISSHMEWNSYYSLLMRCFNEMIKNPNKQKLLLRLICSILDQFHFSDAKDSLDNVSNKGTTDSGM… |
| A0A3P7JV20 | 2-202 | None |
| A0A165C3I9 | 1-231 | None |
| A0A165B7V4 | 123-366 | None |
| A0A183HBC9 | 9-231 | None |
| A0A1D2M6N7 | 177-439 | None |
| A0A498SG42 | 542-805 | None |
| A0A0C2GLC6 | 4-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.